PAB21966

MICALL2 antibody from Abnova Corporation
FLJ23471, JRAB, MGC46023, MICAL-L2

Antibody data

Product number
PAB21966
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21966, RRID:AB_10965383
Product name
MICALL2 polyclonal antibody
Provider product page
Abnova Corporation - PAB21966
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant MICALL2.
Antigen sequence
DVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPG
RPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQ
LQDIERRLDALELRGVELEKRL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -