Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023107-B01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023107-B01, RRID:AB_982715
- Product name
- MRPS27 MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human MRPS27 protein.
- Antigen sequence
MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALD
VLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQ
LDIEETEQSKLPQYLERFKALHSKLQALGKIESEG
LLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDL
VQLIQREQQQREQAKQEYQAQKAAKASA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references hNOA1 interacts with complex I and DAP3 and regulates mitochondrial respiration and apoptosis.
Tang T, Zheng B, Chen SH, Murphy AN, Kudlicka K, Zhou H, Farquhar MG
The Journal of biological chemistry 2009 Feb 20;284(8):5414-24
The Journal of biological chemistry 2009 Feb 20;284(8):5414-24
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MRPS27 expression in transfected 293T cell line (H00023107-T01) by MRPS27 MaxPab polyclonal antibody.Lane 1: MRPS27 transfected lysate(18.48 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MRPS27 MaxPab polyclonal antibody. Western Blot analysis of MRPS27 expression in human kidney.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to MRPS27 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol