HPA001173

TBC1D22A antibody from Sigma-Aldrich
C22orf4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001173
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001173, RRID:AB_1080212
Product name
Anti-TBC1D22A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001173
Antibody type
Polyclonal
Antigen
TBC1 domain family member 22A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HPASGYVQGINDLVTPFFVVFICEYIEAEEVDTVD
VSGVPAEVLCNIEADTYWCMSKLLDGIQDNYTFAQ
PGIQMKVKMLEELVSRIDEQVHRHLDQHEVRYLQF
AFRWMNNLLMREVPLRCTIRLWDTYQSE
Storage
-20C
Provider Type Product Number
- No reagents -