Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084197-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084197-M03, RRID:AB_530044
- Product name
- FLJ23356 monoclonal antibody (M03), clone 6F10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FLJ23356.
- Antigen sequence
GDFVAPEQLWPYGEDVPFHDDLMPSYDEKIDIWKI
PDISSFLLGHIEGSDMVRFHLFDIHKACKSQTPSE
RPTAQDVLETYQKVLDTLRDAMMSQAREML- Isotype
- IgG
- Antibody clone number
- 6F10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FLJ23356 expression in transfected 293T cell line by FLJ23356 monoclonal antibody (M03), clone 6F10.Lane 1: FLJ23356 transfected lysate(38.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FLJ23356 monoclonal antibody (M03), clone 6F10. Western Blot analysis of FLJ23356 expression in HepG2(Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FLJ23356 monoclonal antibody (M03), clone 6F10. Western Blot analysis of FLJ23356 expression in HeLa(Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FLJ23356 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to FLJ23356 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol