Antibody data

Product number
H00000821-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000821-M08, RRID:AB_1137121
Product name
CANX monoclonal antibody (M08), clone 1D4
Provider product page
Abnova Corporation - H00000821-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CANX.
Antigen sequence
SGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKG
DEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPK
AEEDEILNRSPRNRKPRRE
Isotype
IgG
Antibody clone number
1D4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -