HPA027828

POTEA antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027828
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027828, RRID:AB_10603985
Product name
Anti-POTEA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027828
Antibody type
Polyclonal
Antigen
POTE ankyrin domain family, member A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGNGDGGLVPQRKSRKHENQQFPNTEIEEYHRPEK
KSNEKNKVKSQIHSVDNLDDITWPSEIASEDYDLL
FS
Storage
-20C
Provider Type Product Number
- No reagents -