Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010910-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010910-M04, RRID:AB_1112419
- Product name
- SUGT1 monoclonal antibody (M04), clone 1A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SUGT1.
- Antigen sequence
VVITLMIKNVQKNDVNVEFSEKELSALVKLPSGED
YNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAV
RWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNW
DKLVG- Isotype
- IgG
- Antibody clone number
- 1A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SUGT1 monoclonal antibody (M04), clone 1A10. Western Blot analysis of SUGT1 expression in Raw 264.7(Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SUGT1 expression in transfected 293T cell line by SUGT1 monoclonal antibody (M04), clone 1A10.Lane 1: SUGT1 transfected lysate (Predicted MW: 37.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of SUGT1 transfected lysate using anti-SUGT1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SUGT1 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol