HPA012638

GALNT8 antibody from Sigma-Aldrich
GALNAC-T8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012638
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012638, RRID:AB_2294503
Product name
Anti-GALNT8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012638
Antibody type
Polyclonal
Antigen
Probable polypeptide N-acetylgalactosaminyltransferase 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLLDENVCLDQGPFPGNTPIMYYCHEFSSQNVYYH
LTGELYVGQLIAEASASDRCLTDPGKAEKPTLEPC
SKAAKNRLHIYWDFKPGGAVINRDTKRCLEMKKDL
LGSHVLVLQTCSTQVWEIQHTVR
Storage
-20C
Provider Type Product Number
- No reagents -