HPA027201

SPIDR antibody from MilliporeSigma / Merck KGaA
KIAA0146
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027201
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027201, RRID:AB_10603774
Product name
Anti-KIAA0146 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027201
Antibody type
Polyclonal
Antigen
KIAA0146 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENSAKKKLLRGGLAERLNGLQNRERSAISLWRHQC
ISYQKTLSGRKSGVLTVKILELHEECAMQVAMCEQ
LLGSPATSSSQSVAPR
Storage
-20C
Provider Type Product Number
- No reagents -