Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503051 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-UDP Glucuronosyltransferase 2 Family, Polypeptide B4 (UGT2B4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
NIKTILDELVQRGHEVTVLASSASISFDPNSPSTL
KFEVY PVSLTKTEFE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Detoxification enzyme polymorphisms are not involved in duodenal adenomatosis in familial adenomatous polyposis.
Berkhout M, Roelofs HM, te Morsche RH, Dekker E, van Krieken JH, Nagengast FM, Peters WH
The British journal of surgery 2008 Apr;95(4):499-505
The British journal of surgery 2008 Apr;95(4):499-505
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting