HPA013159

LDLR antibody from Sigma-Aldrich
LDLCQ2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013159
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013159, RRID:AB_1852775
Product name
Anti-LDLR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013159
Antibody type
Polyclonal
Antigen
Low-density lipoprotein receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQR
MICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWI
HSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKP
RAI
Storage
-20C
Provider Type Product Number
- No reagents -