Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005100-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005100-M01, RRID:AB_490039
- Product name
- PCDH8 monoclonal antibody (M01), clone 6A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PCDH8.
- Antigen sequence
VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLM
KQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQ
CVLAFDVVSFSQEQFRLVH- Isotype
- IgG
- Antibody clone number
- 6A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of cell surface targets through meta-analysis of microarray data.
Haeberle H, Dudley JT, Liu JT, Butte AJ, Contag CH
Neoplasia (New York, N.Y.) 2012 Jul;14(7):666-9
Neoplasia (New York, N.Y.) 2012 Jul;14(7):666-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PCDH8 monoclonal antibody (M01), clone 6A8 Western Blot analysis of PCDH8 expression in COLO 320 HSR ( Cat # L020V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PCDH8 expression in transfected 293T cell line by PCDH8 monoclonal antibody (M01), clone 6A8.Lane 1: PCDH8 transfected lysate(113 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PCDH8 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PCDH8 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol