HPA010509

PCDH8 antibody from Sigma-Aldrich
ARCADLIN, PAPC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010509
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010509, RRID:AB_10601384
Product name
Anti-PCDH8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010509
Antibody type
Polyclonal
Antigen
protocadherin 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDSDFNDSDSDISGDALKKDLINHMQSGLWACTAE
CKILGHSDRCWSPSCSGPNAHPSPHPPAQMSTFCK
STSLPRDPLRRDNYYQAQLPKTVGLQSVYEKVLHR
DYDRTVTLLSPPRPGRLPDLQEIGVPLYQSPPGRY
LSPKKGANEN
Storage
-20C
Provider Type Product Number
- No reagents -