HPA031528

GMDS antibody from Atlas Antibodies
GMD, SDR3E1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA031528
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA031528, RRID:AB_10558123
Product name
Anti-GMDS
Provider product page
Atlas Antibodies - HPA031528
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQAS
TSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWI
VVNFREAYNLFAVNGILFNHESPRRGAN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -