HPA028213

SULT1E1 antibody from Sigma-Aldrich
EST, STE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028213
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028213, RRID:AB_10599848
Product name
Anti-SULT1E1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028213
Antibody type
Polyclonal
Antigen
sulfotransferase family 1E, estrogen-preferring, member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPF
LECRKENLMNGVKQLDEMNSPRIVKTHLPPEL
Storage
-20C
Provider Type Product Number
- No reagents -