WH0005819M1

NECTIN2 antibody from Sigma-Aldrich
CD112, HVEB, PRR2, PVRL2, PVRR2
ELISA
Recommended by provider

Antibody data

Product number
WH0005819M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0005819M1, RRID:AB_1840510
Product name
Monoclonal Anti-PVRL2 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0005819M1
Antibody type
Monoclonal
Antigen
PVRL2 (AAH03091, a.a. 1-480) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVR
VQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTW
QRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSF
VSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTC
EFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQ
DPTTVALCISKEGRPPARISWLSSLDWEAKETQVS
GTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESF
EEPALIPVTL (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -