Antibody data

Product number
H00005819-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005819-M01, RRID:AB_425639
Product name
PVRL2 monoclonal antibody (M01), clone 2A6-2C1
Provider product page
Abnova Corporation - H00005819-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant PVRL2.
Antigen sequence
MARAAALLPSRSPPTPLLWPLLLLLFLETGAQDVR
VQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTW
QRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSF
VSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTC
EFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQ
DPTTVALCISKEGRPPARISWLSSLDWEAKETQVS
GTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESF
EEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDAT
LSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLV
IHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETP
RASPRDVGPLVWGAVGGTLLVLLLLAGGSLAFILL
RVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDP
VFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPP
PPALEDDMESQLDGSLISRRAVYV
Isotype
IgG
Antibody clone number
2A6-2C1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -