H00007837-M03

PXDN antibody from Abnova Corporation
D2S448, D2S448E, KIAA0230, MG50, PRG2, PXN

Antibody data

Product number
H00007837-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007837-M03, RRID:AB_1137402
Product name
PXDN monoclonal antibody (M03), clone 2C11
Provider product page
Abnova Corporation - H00007837-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PXDN.
Antigen sequence
STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQI
KKLESRLSTTECVDAGGESHANNTKWKKDACTICE
CKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQK
RAEEK
Isotype
IgG
Antibody clone number
2C11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -