HPA012375

PXDN antibody from Sigma-Aldrich
D2S448, D2S448E, KIAA0230, MG50, PRG2, PXN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012375
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012375, RRID:AB_1855965
Product name
Anti-PXDN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012375
Antibody type
Polyclonal
Antigen
Peroxidasin homolog precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARNTIGSASVSMVLSVNVPDVSRNGDPFVATSIVE
AIATVDRAINSTRTHLFDSRPRSPNDLLALFRYPR
DPYTVEQARAGEIFERTLQLIQEHVQHGLMVDLNG
TSYHYNDLVSPQYLNLIANLSGC
Storage
-20C
Provider Type Product Number
- No reagents -