HPA030080

C6orf195 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030080
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030080, RRID:AB_10601694
Product name
Anti-C6orf195 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030080
Antibody type
Polyclonal
Antigen
Uncharacterized protein C6orf195 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CFASLSPEGERAFDGMEPLCQPGARPALRGLQHAS
DCYRLLSPPGSGLVGTNPSVPAPSPHCGCCQAWSI
SSFTFTGPTPFKINSDQATPCHLRSPETI
Storage
-20C
Provider Type Product Number
- No reagents -