Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310147 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKR
VCAGE GLARMELFLL- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Decreased protein and mRNA expression of ER stress proteins GRP78 and GRP94 in HepG2 cells over-expressing CYP2E1.
Dey A, Kessova IG, Cederbaum AI
Archives of biochemistry and biophysics 2006 Mar 15;447(2):155-66
Archives of biochemistry and biophysics 2006 Mar 15;447(2):155-66
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting