HPA009128

CYP2E1 antibody from Atlas Antibodies
CYP2E
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009128
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009128, RRID:AB_1078613
Product name
Anti-CYP2E1
Provider product page
Atlas Antibodies - HPA009128
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEI
QRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPT
LDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYF
KPFSTGKRVCAG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -