HPA009128

CYP2E1 antibody from Sigma-Aldrich
CYP2E
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009128
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009128, RRID:AB_1078613
Product name
Anti-CYP2E1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009128
Antibody type
Polyclonal
Antigen
Cytochrome P450 2E1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEI
QRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPT
LDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYF
KPFSTGKRVCAG
Storage
-20C
Provider Type Product Number
- No reagents -