WH0079133M1

NDUFAF5 antibody from Sigma-Aldrich
C20orf7, dJ842G6.1
ELISA
Recommended by provider

Antibody data

Product number
WH0079133M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0079133M1, RRID:AB_1840393
Product name
Monoclonal Anti-C20orf7 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0079133M1
Antibody type
Monoclonal
Antigen
C20orf7 (AAH05984, a.a. 1-159) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MFGGDTLYELRCSLQLAETEREGGFSPHISPFTAV
NDLGHLLGRAGFNTLTVDTDEIQVNYPGMFELMED
LQGMGESNCAWNRKALLHRDTMLAAAAVYREMYRN
EDGSVPATYQIYYMIGWKYHESQARPAERGSATVS
FGELGKINNLMPPGKKSQ* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -