H00079133-M01

NDUFAF5 antibody from Abnova Corporation
C20orf7, dJ842G6.1
No application information provided.

Antibody data

Product number
H00079133-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079133-M01, RRID:AB_489882
Product name
C20orf7 monoclonal antibody (M01), clone 4A9
Provider product page
Abnova Corporation - H00079133-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant C20orf7.
Antigen sequence
MFGGDTLYELRCSLQLAETEREGGFSPHISPFTAV
NDLGHLLGRAGFNTLTVDTDEIQVNYPGMFELMED
LQGMGESNCAWNRKALLHRDTMLAAAAVYREMYRN
EDGSVPATYQIYYMIGWKYHESQARPAERGSATVS
FGELGKINNLMPPGKKSQ
Isotype
IgG
Antibody clone number
4A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -