HPA051184

NDUFAF5 antibody from Atlas Antibodies
C20orf7, dJ842G6.1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA051184
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA051184, RRID:AB_2681377
Product name
Anti-NDUFAF5
Provider product page
Atlas Antibodies - HPA051184
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VNDLPRALEQIHYILKPDGVFIGAMFGGDTLYELR
CSLQLAETEREGGFSPHISPFTAVNDLGHLLGRAG
FNTLTVDTDEIQVNYPGMFELMED
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -