HPA045337

GPR135 antibody from Atlas Antibodies
HUMNPIIY20, PAFR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA045337
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA045337, RRID:AB_10960528
Product name
Anti-GPR135
Provider product page
Atlas Antibodies - HPA045337
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PNISMLLGRNREEGYRTRNVDAFLPSQGPGLQARS
RSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWA
RKNPVVLFCREGPPEPVTAVTKQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -