H00064582-M01

GPR135 antibody from Abnova Corporation
HUMNPIIY20, PAFR

Antibody data

Product number
H00064582-M01
Provider
Abnova Corporation
Product name
GPR135 monoclonal antibody (M01), clone 1H5
Provider product page
Abnova Corporation - H00064582-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GPR135.
Antigen sequence
NPNISMLLGRNREEGYRTRNVDAFLPSQGPGLQAR
SRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMW
ARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTS
Isotype
IgG
Antibody clone number
1H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -