HPA009130

PNPLA7 antibody from Atlas Antibodies
C9orf111, FLJ31318, FLJ43070, FLJ44279, NTE-R1, NTEL1, RP11-48C7.2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009130
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009130, RRID:AB_888710
Product name
Anti-PNPLA7
Provider product page
Atlas Antibodies - HPA009130
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CEVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKP
ASAVLTCPNASFTDLAEIVSRIEPAKPAMVDDESD
YQTEYEEELLDVPRDAYADFQSTSAQQGSDLEDES
SLRHRHPSLAFPKLSE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -