HPA009130

PNPLA7 antibody from Sigma-Aldrich
C9orf111, FLJ31318, FLJ43070, FLJ44279, NTE-R1, NTEL1, RP11-48C7.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009130
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009130, RRID:AB_2268411
Product name
Anti-PNPLA7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009130
Antibody type
Polyclonal
Antigen
patatin-like phospholipase domain containing 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CEVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKP
ASAVLTCPNASFTDLAEIVSRIEPAKPAMVDDESD
YQTEYEEELLDVPRDAYADFQSTSAQQGSDLEDES
SLRHRHPSLAFPKLSE
Storage
-20C
Provider Type Product Number
- No reagents -