H00081624-M01

DIAPH3 antibody from Abnova Corporation
AN, AUNA1, DRF3, FLJ34705, NSDAN

Antibody data

Product number
H00081624-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00081624-M01, RRID:AB_1137174
Product name
DIAPH3 monoclonal antibody (M01), clone 4D5
Provider product page
Abnova Corporation - H00081624-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DIAPH3.
Antigen sequence
PDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQL
QQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQY
ETLSKLHENMEKLYQSIIGYYAIDVKKV
Isotype
IgG
Antibody clone number
4D5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -