HPA013204

GGT7 antibody from Sigma-Aldrich
D20S101, dJ18C9.2, GGTL3, GGTL5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013204
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013204, RRID:AB_1850347
Product name
Anti-GGT7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013204
Antibody type
Polyclonal
Antigen
Gamma-glutamyltransferase 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLVLSPPPPHTGPALISALNILEGFNLTSLVSREQ
ALHWVAETLKIALALASRLGDPVYDSTITESMDDM
LSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTA
AQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILL
NS
Storage
-20C
Provider Type Product Number
- No reagents -