HPA013204

GGT7 antibody from Atlas Antibodies
D20S101, dJ18C9.2, GGTL3, GGTL5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013204
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013204, RRID:AB_1234451
Product name
Anti-GGT7
Provider product page
Atlas Antibodies - HPA013204
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HLVLSPPPPHTGPALISALNILEGFNLTSLVSREQ
ALHWVAETLKIALALASRLGDPVYDSTITESMDDM
LSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTA
AQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILL
NS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -