HPA013204

GGT7 antibody from Atlas Antibodies
D20S101, dJ18C9.2, GGTL3, GGTL5

Antibody data

Product number
HPA013204
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013204, RRID:AB_1850347
Product name
Anti-GGT7
Provider product page
Atlas Antibodies - HPA013204
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HLVLSPPPPHTGPALISALNILEGFNLTSLVSREQ
ALHWVAETLKIALALASRLGDPVYDSTITESMDDM
LSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTA
AQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILL
NS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.