HPA001220

GAL3ST1 antibody from Sigma-Aldrich
CST
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001220
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001220, RRID:AB_1078933
Product name
Anti-GAL3ST1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001220
Antibody type
Polyclonal
Antigen
Galactosylceramide sulfotransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLNILFRFGQKHRLKFAFPNGRNDFDYPTFFARSL
VQDYRPGACFNIICNHMRFHYDEVRGLVPTNAIFI
TVLRDPARLFESSFHYFGPVVPLTWKLSAGDKLTE
FLQDPDRYYDPNGFNAHYLRNLLFFDLGYDNSLDP
SSPQVQEHIL
Storage
-20C
Provider Type Product Number
- No reagents -