HPA017076

GALNT15 antibody from MilliporeSigma / Merck KGaA
GALNT7, GALNTL2, pp-GalNAc-T15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017076
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017076, RRID:AB_1849458
Product name
Anti-GALNTL2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017076
Antibody type
Polyclonal
Antigen
Polypeptide N-acetylgalactosaminyltransferase-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGSVEILPCSRVGHIYQNQDSHSPLDQEATLRNRV
RIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMER
LQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGK
LHNTGLG
Storage
-20C
Provider Type Product Number
- No reagents -