HPA017076

GALNT15 antibody from Atlas Antibodies
GALNT7, GALNTL2, pp-GalNAc-T15
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017076
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017076, RRID:AB_1849458
Product name
Anti-GALNT15
Provider product page
Atlas Antibodies - HPA017076
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GGSVEILPCSRVGHIYQNQDSHSPLDQEATLRNRV
RIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMER
LQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGK
LHNTGLG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -