HPA000528

PITPNB antibody from Sigma-Aldrich
VIB1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000528
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000528, RRID:AB_1079622
Product name
Anti-PITPNB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000528
Antibody type
Polyclonal
Antigen
Phosphatidylinositol transfer protein beta-isoform recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEP
YEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLV
FHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKP
DLGTLENVHGLDPNT
Storage
-20C
Provider Type Product Number
- No reagents -