Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006652-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006652-M01, RRID:AB_607073
- Product name
- SORD monoclonal antibody (M01), clone 4D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SORD.
- Antigen sequence
MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEV
LLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGH
EASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEF
CKMGR- Isotype
- IgG
- Antibody clone number
- 4D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Sorbitol dehydrogenase expression is regulated by androgens in the human prostate.
Szabó Z, Hämäläinen J, Loikkanen I, Moilanen AM, Hirvikoski P, Väisänen T, Paavonen TK, Vaarala MH
Oncology reports 2010 May;23(5):1233-9
Oncology reports 2010 May;23(5):1233-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SORD expression in transfected 293T cell line by SORD monoclonal antibody (M01), clone 4D3.Lane 1: SORD transfected lysate(38.165 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SORD monoclonal antibody (M01), clone 4D3. Western Blot analysis of SORD expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SORD is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SORD on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol