HPA017068

PNKD antibody from Sigma-Aldrich
BRP17, DKFZp564N1362, DYT8, FKSG19, FPD1, KIAA1184, KIPP1184, MGC31943, MR-1, PDC, PKND1, TAHCCP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017068
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017068, RRID:AB_1855495
Product name
Anti-PNKD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017068
Antibody type
Polyclonal
Antigen
Probable hydrolase PNKD recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REVDKDRVKQMKARQNMRLSNTGEYESQRFRASSQ
SAPSPDVGSGVQ
Storage
-20C
Provider Type Product Number
- No reagents -