HPA010135

TNFRSF19 antibody from Sigma-Aldrich
TAJ, TAJ-alpha, TRADE, TROY
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010135
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010135, RRID:AB_1079797
Product name
Anti-TNFRSF19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010135
Antibody type
Polyclonal
Antigen
Tumor necrosis factor receptor superfamily member 19 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFG
YGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNR
FQKANCSATSDAICGDCLPGF
Storage
-20C
Provider Type Product Number
- No reagents -