HPA010136

POR antibody from Sigma-Aldrich
CYPOR, FLJ26468
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010136
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010136, RRID:AB_1079657
Product name
Anti-POR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010136
Antibody type
Polyclonal
Antigen
NADPH--cytochrome P450 reductase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEEVPEFTKIQTLTSSVRESSFVEKMKKTGRNIIV
FYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEY
DLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDF
YDWLQETDVDLSGVKFAVFGLGNKTYEHFNA
Storage
-20C
Provider Type Product Number
- No reagents -