Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008507-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008507-M02, RRID:AB_529980
- Product name
- ENC1 monoclonal antibody (M02), clone 3B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ENC1.
- Antigen sequence
SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLH
AGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSE
VNFDNSIHPEVL- Isotype
- IgG
- Antibody clone number
- 3B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Characterization of differential gene expression in adrenocortical tumors harboring beta-catenin (CTNNB1) mutations.
Durand J, Lampron A, Mazzuco TL, Chapman A, Bourdeau I
The Journal of clinical endocrinology and metabolism 2011 Jul;96(7):E1206-11
The Journal of clinical endocrinology and metabolism 2011 Jul;96(7):E1206-11
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ENC1 monoclonal antibody (M02), clone 3B1 Western Blot analysis of ENC1 expression in IMR-32 ( Cat # L008V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ENC1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol