Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055135-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055135-M04, RRID:AB_1205172
- Product name
- WDR79 monoclonal antibody (M04), clone 1F12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant WDR79.
- Antigen sequence
AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQ
ELSENTSLPAEEANGSLSEEEANGPELGSGKAMED
TSGEPAAEDEGDTAWNYSFSQLPRFLSGS- Isotype
- IgG
- Antibody clone number
- 1F12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The scaffold protein WRAP53β orchestrates the ubiquitin response critical for DNA double-strand break repair.
Henriksson S, Rassoolzadeh H, Hedström E, Coucoravas C, Julner A, Goldstein M, Imreh G, Zhivotovsky B, Kastan MB, Helleday T, Farnebo M
Genes & development 2014 Dec 15;28(24):2726-38
Genes & development 2014 Dec 15;28(24):2726-38
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- WDR79 monoclonal antibody (M04), clone 1F12. Western Blot analysis of WDR79 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged WDR79 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to WDR79 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol