HPA010019

C1orf159 antibody from Sigma-Aldrich
FLJ20584
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010019
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010019, RRID:AB_1078885
Product name
Anti-C1orf159 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010019
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf159 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVTSMLFPVPETWGLQERRTHHDRADPQYLLLLEV
QLHPRTDAAGLRQALLSSHRFSGAGSGGPKSQPVR
KPRYVRRERPLDRATDPAAFPGEARISNV
Storage
-20C
Provider Type Product Number
- No reagents -