Antibody data

Product number
H00000754-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000754-M04, RRID:AB_1204879
Product name
PTTG1IP monoclonal antibody (M04), clone 4C11
Provider product page
Abnova Corporation - H00000754-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PTTG1IP.
Antigen sequence
MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEP
PGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYP
VTSVLPPASLCKLSSARWGVCWVNFEALIITMSVV
GGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMRER
EERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYA
RFENN
Isotype
IgG
Antibody clone number
4C11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -