HPA012373

FMO5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012373
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012373, RRID:AB_1848975
Product name
Anti-FMO5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012373
Antibody type
Polyclonal
Antigen
Dimethylaniline monooxygenase [N-oxide-forming] 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAE
ISKAQEEIDKRYVESQRHTIQGDYIDTMEELADLV
GVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGP
GKWDGARKAILTTDD
Storage
-20C
Provider Type Product Number
- No reagents -