Antibody data
- Antibody Data
- Antigen structure
- References [36]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
- Flow cytometry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA50AG - Provider product page

- Provider
- ReliaTech GmbH
- Product name
- Lyve-1
- Antibody type
- Polyclonal
- Antigen
- Recombinant human soluble LYVE-1
- Description
- antibody affinity purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
SLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAK
EACRLLGLSLAGKDQVETALKASFETCSYGWVGDG
FVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYC
YNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFI
VSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKK
LICVTEVFMETSTMSTETEPFVENKAAFKNEAAGH
HHHHH- Antibody clone number
- Rabbit IG
- Vial size
- 50 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Submitted references Novel Blood Vascular Endothelial Subtype-Specific Markers in Human Skin Unearthed by Single-Cell Transcriptomic Profiling.
Stage I-IV Colorectal Cancer Prognosis Can Be Predicted by Type and Number of Intratumoral Macrophages and CLEVER-1+ Vessel Density.
Upregulation of VCAM-1 in lymphatic collectors supports dendritic cell entry and rapid migration to lymph nodes in inflammation.
Absence of lymphatic vessels in term placenta.
TGFβ counteracts LYVE-1-mediated induction of lymphangiogenesis by small hyaluronan oligosaccharides
ELM: A New, Simple, and Economic Assay to Measure Motility of Lymphatic Endothelial Cells
Engineering Blood and Lymphatic Microvascular Networks in Fibrin Matrices
Orbital Angiogenesis and Lymphangiogenesis in Thyroid Eye Disease
Fetal liver endothelium regulates the seeding of tissue-resident macrophages
Morphological and Molecular Characterization of Human Dermal Lymphatic Collectors
TGF-β1-induced EMT promotes targeted migration of breast cancer cells through the lymphatic system by the activation of CCR7/CCL21-mediated chemotaxis
Generation of pure lymphatic endothelial cells from human pluripotent stem cells and their therapeutic effects on wound repair
The endothelial protein PLVAP in lymphatics controls the entry of lymphocytes and antigens into lymph nodes
Understanding Lymphatic Drainage Pathways of the Ovaries to Predict Sites for Sentinel Nodes in Ovarian Cancer
Lymphangiogenesis and angiogenesis in abdominal aortic aneurysm.
Lymphangiogenesis and angiogenesis during human fetal pancreas development
Adhesion of Pancreatic Cancer Cells in a Liver-Microvasculature Mimicking Coculture Correlates with Their Propensity to Form Liver-Specific Metastasis
High density of peritumoral lymphatic vessels measured by D2-40/podoplanin and LYVE-1 expression in gastric cancer patients: an excellent prognostic indicator or a false friend?
Lack of Lymphatics and Lymph Node-Mediated Immunity in Choroidal Neovascularization
Increased lymphatic vessel density and lymphangiogenesis in inflammatory bowel disease
Exercise-induced decline in the density of LYVE-1-positive lymphatic vessels in human skeletal muscle.
Thymus cell antigen 1 (Thy1, CD90) is expressed by lymphatic vessels and mediates cell adhesion to lymphatic endothelium
Vascular Endothelial Growth Factor Receptors VEGFR-2 and VEGFR-3 Are Localized Primarily to the Vasculature in Human Primary Solid Cancers
An exquisite cross-control mechanism among endothelial cell fate regulators directs the plasticity and heterogeneity of lymphatic endothelial cells
Immunohistochemical methods for measuring tissue lymphangiogenesis.
Endothelin-1 Stimulates Lymphatic Endothelial Cells and Lymphatic Vessels to Grow and Invade
The lymphatic ring assay: a 3D-culture model of lymphangiogenesis
Endosialin (Tem1) Is a Marker of Tumor-Associated Myofibroblasts and Tumor Vessel-Associated Mural Cells
Altered regulation of Prox1-gene-expression in liver tumors
Similarities and differences of human and experimental mouse lymphangiomas
Elevated expression of VEGFR-3 in lymphatic endothelial cells from lymphangiomas
Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1.
Induction of lymphangiogenesis in and around axillary lymph node metastases of patients with breast cancer
Differentiation of Lymphatic Endothelial Cells From Embryonic Stem Cells on OP9 Stromal Cells
Isolation and characterization of lymphatic microvascular endothelial cells from human tonsils
Tumor Lymphangiogenesis in Inflammatory Breast Carcinoma: A Histomorphometric Study
He Y, Tacconi C, Dieterich LC, Kim J, Restivo G, Gousopoulos E, Lindenblatt N, Levesque MP, Claassen M, Detmar M
Cells 2022 Mar 25;11(7)
Cells 2022 Mar 25;11(7)
Stage I-IV Colorectal Cancer Prognosis Can Be Predicted by Type and Number of Intratumoral Macrophages and CLEVER-1+ Vessel Density.
Ålgars A, Kemppinen L, Fair-Mäkelä R, Mustonen H, Haglund C, Jalkanen S
Cancers 2021 Nov 28;13(23)
Cancers 2021 Nov 28;13(23)
Upregulation of VCAM-1 in lymphatic collectors supports dendritic cell entry and rapid migration to lymph nodes in inflammation.
Arasa J, Collado-Diaz V, Kritikos I, Medina-Sanchez JD, Friess MC, Sigmund EC, Schineis P, Hunter MC, Tacconi C, Paterson N, Nagasawa T, Kiefer F, Makinen T, Detmar M, Moser M, Lämmermann T, Halin C
The Journal of experimental medicine 2021 Jul 5;218(7)
The Journal of experimental medicine 2021 Jul 5;218(7)
Absence of lymphatic vessels in term placenta.
Becker J, Tchagou Tchangou GE, Schmidt S, Zelent C, Kahl F, Wilting J
BMC pregnancy and childbirth 2020 Jun 29;20(1):380
BMC pregnancy and childbirth 2020 Jun 29;20(1):380
TGFβ counteracts LYVE-1-mediated induction of lymphangiogenesis by small hyaluronan oligosaccharides
Bauer J, Rothley M, Schmaus A, Quagliata L, Ehret M, Biskup M, Orian-Rousseau V, Jackson D, Pettis R, Harvey A, Bräse S, Thiele W, Sleeman J
Journal of Molecular Medicine 2018 February;96(2):199-209
Journal of Molecular Medicine 2018 February;96(2):199-209
ELM: A New, Simple, and Economic Assay to Measure Motility of Lymphatic Endothelial Cells
Torri F, Dell'Era P, Garrafa E
Lymphatic Research and Biology 2017 March;15(1):39-44
Lymphatic Research and Biology 2017 March;15(1):39-44
Engineering Blood and Lymphatic Microvascular Networks in Fibrin Matrices
Knezevic L, Schaupper M, Mühleder S, Schimek K, Hasenberg T, Marx U, Priglinger E, Redl H, Holnthoner W
Frontiers in Bioengineering and Biotechnology 2017 April;5
Frontiers in Bioengineering and Biotechnology 2017 April;5
Orbital Angiogenesis and Lymphangiogenesis in Thyroid Eye Disease
Wong L, Lee N, Amarnani D, Choi C, Bielenberg D, Freitag S, D'Amore P, Kim L
Ophthalmology 2016 September;123(9):2028-2036
Ophthalmology 2016 September;123(9):2028-2036
Fetal liver endothelium regulates the seeding of tissue-resident macrophages
Rantakari P, Jäppinen N, Lokka E, Mokkala E, Gerke H, Peuhu E, Ivaska J, Elima K, Auvinen K, Salmi M
Nature 2016 October;538(7625):392-396
Nature 2016 October;538(7625):392-396
Morphological and Molecular Characterization of Human Dermal Lymphatic Collectors
Hasselhof V, Sperling A, Buttler K, Ströbel P, Becker J, Aung T, Felmerer G, Wilting J, Dettman R
PLOS ONE 2016 October;11(10)
PLOS ONE 2016 October;11(10)
TGF-β1-induced EMT promotes targeted migration of breast cancer cells through the lymphatic system by the activation of CCR7/CCL21-mediated chemotaxis
Pang M, Georgoudaki A, Lambut L, Johansson J, Tabor V, Hagikura K, Jin Y, Jansson M, Alexander J, Nelson C, Jakobsson L, Betsholtz C, Sund M, Karlsson M, Fuxe J
Oncogene 2016 February;35(6):748-760
Oncogene 2016 February;35(6):748-760
Generation of pure lymphatic endothelial cells from human pluripotent stem cells and their therapeutic effects on wound repair
Lee S, Park C, Lee J, Kim S, Kwon P, Kim W, Jeon Y, Lee E, Yoon Y
Scientific Reports 2015 September;5(1)
Scientific Reports 2015 September;5(1)
The endothelial protein PLVAP in lymphatics controls the entry of lymphocytes and antigens into lymph nodes
Rantakari P, Auvinen K, Jäppinen N, Kapraali M, Valtonen J, Karikoski M, Gerke H, Iftakhar-E-Khuda I, Keuschnigg J, Umemoto E, Tohya K, Miyasaka M, Elima K, Jalkanen S, Salmi M
Nature Immunology 2015 April;16(4):386-396
Nature Immunology 2015 April;16(4):386-396
Understanding Lymphatic Drainage Pathways of the Ovaries to Predict Sites for Sentinel Nodes in Ovarian Cancer
Kleppe M, Kraima A, Kruitwagen R, Van Gorp T, Smit N, van Munsteren J, DeRuiter M
International Journal of Gynecological Cancer 2015 ;25(8):1405-1414
International Journal of Gynecological Cancer 2015 ;25(8):1405-1414
Lymphangiogenesis and angiogenesis in abdominal aortic aneurysm.
Sano M, Sasaki T, Hirakawa S, Sakabe J, Ogawa M, Baba S, Zaima N, Tanaka H, Inuzuka K, Yamamoto N, Setou M, Sato K, Konno H, Unno N
PloS one 2014;9(3):e89830
PloS one 2014;9(3):e89830
Lymphangiogenesis and angiogenesis during human fetal pancreas development
Roost M, van Iperen L, de Melo Bernardo A, Mummery C, Carlotti F, de Koning E, Chuva de Sousa Lopes S
Vascular Cell 2014 ;6(1):22
Vascular Cell 2014 ;6(1):22
Adhesion of Pancreatic Cancer Cells in a Liver-Microvasculature Mimicking Coculture Correlates with Their Propensity to Form Liver-Specific Metastasis
Chowdhury M, Danoy M, Rahman F, Shinohara M, Kaneda S, Shiba K, Fujita N, Fujii T, Sakai Y
BioMed Research International 2014 ;2014
BioMed Research International 2014 ;2014
High density of peritumoral lymphatic vessels measured by D2-40/podoplanin and LYVE-1 expression in gastric cancer patients: an excellent prognostic indicator or a false friend?
Rudno-Rudzinska J, Kielan W, Grzebieniak Z, Dziegiel P, Donizy P, Mazur G, Knakiewicz M, Frejlich E, Halon A
Gastric Cancer 2013 October;16(4):513-520
Gastric Cancer 2013 October;16(4):513-520
Lack of Lymphatics and Lymph Node-Mediated Immunity in Choroidal Neovascularization
Nakao S, Zandi S, Kohno R, Sun D, Nakama T, Ishikawa K, Yoshida S, Enaida H, Ishibashi T, Hafezi-Moghadam A
Investigative Ophthalmology & Visual Science 2013 June;54(6):3830-3836
Investigative Ophthalmology & Visual Science 2013 June;54(6):3830-3836
Increased lymphatic vessel density and lymphangiogenesis in inflammatory bowel disease
Rahier J, De Beauce S, Dubuquoy L, Erdual E, Colombel J, Jouret-Mourin A, Geboes K, Desreumaux P
Alimentary Pharmacology & Therapeutics 2011 September;34(5):533-543
Alimentary Pharmacology & Therapeutics 2011 September;34(5):533-543
Exercise-induced decline in the density of LYVE-1-positive lymphatic vessels in human skeletal muscle.
Gehlert S, Theis C, Weber S, Schiffer T, Hellmich M, Platen P, Bloch W
Lymphatic research and biology 2010 Sep;8(3):165-73
Lymphatic research and biology 2010 Sep;8(3):165-73
Thymus cell antigen 1 (Thy1, CD90) is expressed by lymphatic vessels and mediates cell adhesion to lymphatic endothelium
Jurisic G, Iolyeva M, Proulx S, Halin C, Detmar M
Experimental Cell Research 2010 October;316(17):2982-2992
Experimental Cell Research 2010 October;316(17):2982-2992
Vascular Endothelial Growth Factor Receptors VEGFR-2 and VEGFR-3 Are Localized Primarily to the Vasculature in Human Primary Solid Cancers
Smith N, Baker D, James N, Ratcliffe K, Jenkins M, Ashton S, Sproat G, Swann R, Gray N, Ryan A, Jurgensmeier J, Womack C
Clinical Cancer Research 2010 July;16(14):3548-3561
Clinical Cancer Research 2010 July;16(14):3548-3561
An exquisite cross-control mechanism among endothelial cell fate regulators directs the plasticity and heterogeneity of lymphatic endothelial cells
Kang J, Yoo J, Lee S, Tang W, Aguilar B, Ramu S, Choi I, Otu H, Shin J, Dotto G, Koh C, Detmar M, Hong Y
Blood 2010 July;116(1):140-150
Blood 2010 July;116(1):140-150
Immunohistochemical methods for measuring tissue lymphangiogenesis.
Clasper S, Jackson DG
Methods in molecular biology (Clifton, N.J.) 2009;467:79-91
Methods in molecular biology (Clifton, N.J.) 2009;467:79-91
Endothelin-1 Stimulates Lymphatic Endothelial Cells and Lymphatic Vessels to Grow and Invade
Spinella F, Garrafa E, Di Castro V, Rosano L, Nicotra M, Caruso A, Natali P, Bagnato A
Cancer Research 2009 March;69(6):2669-2676
Cancer Research 2009 March;69(6):2669-2676
The lymphatic ring assay: a 3D-culture model of lymphangiogenesis
Françoise B, Laurence M, Sarah B, Olivier P, Jean-Michel F, Agnès N
Protocol Exchange 2008 May
Protocol Exchange 2008 May
Endosialin (Tem1) Is a Marker of Tumor-Associated Myofibroblasts and Tumor Vessel-Associated Mural Cells
Christian S, Winkler R, Helfrich I, Boos A, Besemfelder E, Schadendorf D, Augustin H
The American Journal of Pathology 2008 February;172(2):486-494
The American Journal of Pathology 2008 February;172(2):486-494
Altered regulation of Prox1-gene-expression in liver tumors
Dudas J, Mansuroglu T, Moriconi F, Haller F, Wilting J, Lorf T, Füzesi L, Ramadori G
BMC Cancer 2008 ;8(1):92
BMC Cancer 2008 ;8(1):92
Similarities and differences of human and experimental mouse lymphangiomas
Kasten P, Schnöink G, Bergmann A, Papoutsi M, Buttler K, Rössler J, Weich H, Wilting J
Developmental Dynamics 2007 October;236(10):2952-2961
Developmental Dynamics 2007 October;236(10):2952-2961
Elevated expression of VEGFR-3 in lymphatic endothelial cells from lymphangiomas
Norgall S, Papoutsi M, Rössler J, Schweigerer L, Wilting J, Weich H
BMC Cancer 2007 December;7(1)
BMC Cancer 2007 December;7(1)
Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1.
Kilic N, Oliveira-Ferrer L, Neshat-Vahid S, Irmak S, Obst-Pernberg K, Wurmbach JH, Loges S, Kilic E, Weil J, Lauke H, Tilki D, Singer BB, Ergün S
Blood 2007 Dec 15;110(13):4223-33
Blood 2007 Dec 15;110(13):4223-33
Induction of lymphangiogenesis in and around axillary lymph node metastases of patients with breast cancer
Van den Eynden G, Van der Auwera I, Van Laere S, Huygelen V, Colpaert C, van Dam P, Dirix L, Vermeulen P, Van Marck E
British Journal of Cancer 2006 November;95(10):1362-1366
British Journal of Cancer 2006 November;95(10):1362-1366
Differentiation of Lymphatic Endothelial Cells From Embryonic Stem Cells on OP9 Stromal Cells
Kono T
Arteriosclerosis, Thrombosis, and Vascular Biology 2006 June;26(9):2070-2076
Arteriosclerosis, Thrombosis, and Vascular Biology 2006 June;26(9):2070-2076
Isolation and characterization of lymphatic microvascular endothelial cells from human tonsils
Garrafa E, Alessandri G, Benetti A, Turetta D, Corradi A, Cantoni A, Cervi E, Bonardelli S, Parati E, Giulini S, Ensoli B, Caruso A
Journal of Cellular Physiology 2006 April;207(1):107-113
Journal of Cellular Physiology 2006 April;207(1):107-113
Tumor Lymphangiogenesis in Inflammatory Breast Carcinoma: A Histomorphometric Study
Van der Auwera I
Clinical Cancer Research 2005 November;11(21):7637-7642
Clinical Cancer Research 2005 November;11(21):7637-7642
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Western analysis of recombinant human sLYVE-1 [Cat# S01-028] and mouse sLYVE-1 [Cat# S01-026] using an anti-human LYVE-1 polyclonal antibody [Cat# 102-PA50] directed against the extracellular domain of human LYVE-1. There is more or less no cross reactivity with mouse LYVE-1.
- Sample type
- Purified recombinant proteins
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Immunohistochemical staining of the lymphatic vessels with anti-human LYVE-1 polyclonal antibody. (A) malignant canine mammary tumor; (B) benign canine mammary tumor; (C) normal canine mammary gland tissue. The experiment was performed by the research group of Applied Veterinary Morphology – University of Antwerp
- Sample type
- Malignant canine mammary tmour tissue
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Human intestine (border area of a colon carcinoma): The experiment has been performed by Dr. Karsten Debel, DCS, Hamburg, Germany
- Sample type
- human intestin
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- FACS analysis with primary human dermal microvascular endothelial cells (HDMVEC).
- Sample type
- HDMVEC