Antibody data
- Antibody Data
- Antigen structure
- References [35]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
- Flow cytometry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA50 - Provider product page

- Provider
- ReliaTech GmbH
- Product name
- Lyve-1
- Antibody type
- Polyclonal
- Antigen
- Recombinant human soluble LYVE-1
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
SLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAK
EACRLLGLSLAGKDQVETALKASFETCSYGWVGDG
FVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYC
YNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFI
VSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKK
LICVTEVFMETSTMSTETEPFVENKAAFKNEAAGH
HHHHH- Antibody clone number
- Rabbit IG
- Vial size
- 200 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Submitted references Upregulation of VCAM-1 in lymphatic collectors supports dendritic cell entry and rapid migration to lymph nodes in inflammation.
TGFβ counteracts LYVE-1-mediated induction of lymphangiogenesis by small hyaluronan oligosaccharides
ELM: A New, Simple, and Economic Assay to Measure Motility of Lymphatic Endothelial Cells
Engineering Blood and Lymphatic Microvascular Networks in Fibrin Matrices
Tissue-engineered 3D human lymphatic microvascular network for in vitro studies of lymphangiogenesis
Orbital Angiogenesis and Lymphangiogenesis in Thyroid Eye Disease
Morphological and Molecular Characterization of Human Dermal Lymphatic Collectors
Inflammation and Lymphedema Are Exacerbated and Prolonged by Neuropilin 2 Deficiency
TGF-β1-induced EMT promotes targeted migration of breast cancer cells through the lymphatic system by the activation of CCR7/CCL21-mediated chemotaxis
Generation of pure lymphatic endothelial cells from human pluripotent stem cells and their therapeutic effects on wound repair
Understanding Lymphatic Drainage Pathways of the Ovaries to Predict Sites for Sentinel Nodes in Ovarian Cancer
Lymphangiogenesis and angiogenesis in abdominal aortic aneurysm.
Molecular and Cellular Effects of In Vitro Shockwave Treatment on Lymphatic Endothelial Cells
Adhesion of Pancreatic Cancer Cells in a Liver-Microvasculature Mimicking Coculture Correlates with Their Propensity to Form Liver-Specific Metastasis
High density of peritumoral lymphatic vessels measured by D2-40/podoplanin and LYVE-1 expression in gastric cancer patients: an excellent prognostic indicator or a false friend?
A role for all-trans-retinoic acid in the early steps of lymphatic vasculature development.
Lack of Evidence for the Direct Activation of Endothelial Cells by Adult Female and Microfilarial Excretory-Secretory Products
Thymus cell antigen 1 (Thy1, CD90) is expressed by lymphatic vessels and mediates cell adhesion to lymphatic endothelium
Endostatin inhibits tumour lymphangiogenesis and lymphatic metastasis via cell surface nucleolin on lymphangiogenic endothelial cells
An exquisite cross-control mechanism among endothelial cell fate regulators directs the plasticity and heterogeneity of lymphatic endothelial cells
Suppression of Prostate Cancer Nodal and Systemic Metastasis by Blockade of the Lymphangiogenic Axis
The lymphatic ring assay: a 3D-culture model of lymphangiogenesis
Heterogeneity in Immunohistochemical, Genomic, and Biological Properties of Human Lymphatic Endothelial Cells Between Initial and Collecting Lymph Vessels
Jugular Lymphatic Maldevelopment in Turner Syndrome and Trisomy 21: Different Anomalies Leading to Nuchal Edema
Endosialin (Tem1) Is a Marker of Tumor-Associated Myofibroblasts and Tumor Vessel-Associated Mural Cells
Altered regulation of Prox1-gene-expression in liver tumors
Similarities and differences of human and experimental mouse lymphangiomas
Melanoma contains CD133 and ABCG2 positive cells with enhanced tumourigenic potential
Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1
Induction of lymphangiogenesis in and around axillary lymph node metastases of patients with breast cancer
Differentiation of Lymphatic Endothelial Cells From Embryonic Stem Cells on OP9 Stromal Cells
Isolation and characterization of lymphatic microvascular endothelial cells from human tonsils
Tumor Lymphangiogenesis in Inflammatory Breast Carcinoma: A Histomorphometric Study
Isolation, purification, and heterogeneity of human lymphatic endothelial cells from different tissues.
Elevated expression of VEGFR-3 in lymphatic endothelial cells from lymphangiomas
Arasa J, Collado-Diaz V, Kritikos I, Medina-Sanchez JD, Friess MC, Sigmund EC, Schineis P, Hunter MC, Tacconi C, Paterson N, Nagasawa T, Kiefer F, Makinen T, Detmar M, Moser M, Lämmermann T, Halin C
The Journal of experimental medicine 2021 Jul 5;218(7)
The Journal of experimental medicine 2021 Jul 5;218(7)
TGFβ counteracts LYVE-1-mediated induction of lymphangiogenesis by small hyaluronan oligosaccharides
Bauer J, Rothley M, Schmaus A, Quagliata L, Ehret M, Biskup M, Orian-Rousseau V, Jackson D, Pettis R, Harvey A, Bräse S, Thiele W, Sleeman J
Journal of Molecular Medicine 2018 February;96(2):199-209
Journal of Molecular Medicine 2018 February;96(2):199-209
ELM: A New, Simple, and Economic Assay to Measure Motility of Lymphatic Endothelial Cells
Torri F, Dell'Era P, Garrafa E
Lymphatic Research and Biology 2017 March;15(1):39-44
Lymphatic Research and Biology 2017 March;15(1):39-44
Engineering Blood and Lymphatic Microvascular Networks in Fibrin Matrices
Knezevic L, Schaupper M, Mühleder S, Schimek K, Hasenberg T, Marx U, Priglinger E, Redl H, Holnthoner W
Frontiers in Bioengineering and Biotechnology 2017 April;5
Frontiers in Bioengineering and Biotechnology 2017 April;5
Tissue-engineered 3D human lymphatic microvascular network for in vitro studies of lymphangiogenesis
Gibot L, Galbraith T, Bourland J, Rogic A, Skobe M, Auger F
Nature Protocols 2017 April;12(5):1077-1088
Nature Protocols 2017 April;12(5):1077-1088
Orbital Angiogenesis and Lymphangiogenesis in Thyroid Eye Disease
Wong L, Lee N, Amarnani D, Choi C, Bielenberg D, Freitag S, D'Amore P, Kim L
Ophthalmology 2016 September;123(9):2028-2036
Ophthalmology 2016 September;123(9):2028-2036
Morphological and Molecular Characterization of Human Dermal Lymphatic Collectors
Hasselhof V, Sperling A, Buttler K, Ströbel P, Becker J, Aung T, Felmerer G, Wilting J, Dettman R
PLOS ONE 2016 October;11(10)
PLOS ONE 2016 October;11(10)
Inflammation and Lymphedema Are Exacerbated and Prolonged by Neuropilin 2 Deficiency
Mucka P, Levonyak N, Geretti E, Zwaans B, Li X, Adini I, Klagsbrun M, Adam R, Bielenberg D
The American Journal of Pathology 2016 November;186(11):2803-2812
The American Journal of Pathology 2016 November;186(11):2803-2812
TGF-β1-induced EMT promotes targeted migration of breast cancer cells through the lymphatic system by the activation of CCR7/CCL21-mediated chemotaxis
Pang M, Georgoudaki A, Lambut L, Johansson J, Tabor V, Hagikura K, Jin Y, Jansson M, Alexander J, Nelson C, Jakobsson L, Betsholtz C, Sund M, Karlsson M, Fuxe J
Oncogene 2016 February;35(6):748-760
Oncogene 2016 February;35(6):748-760
Generation of pure lymphatic endothelial cells from human pluripotent stem cells and their therapeutic effects on wound repair
Lee S, Park C, Lee J, Kim S, Kwon P, Kim W, Jeon Y, Lee E, Yoon Y
Scientific Reports 2015 September;5(1)
Scientific Reports 2015 September;5(1)
Understanding Lymphatic Drainage Pathways of the Ovaries to Predict Sites for Sentinel Nodes in Ovarian Cancer
Kleppe M, Kraima A, Kruitwagen R, Van Gorp T, Smit N, van Munsteren J, DeRuiter M
International Journal of Gynecological Cancer 2015 ;25(8):1405-1414
International Journal of Gynecological Cancer 2015 ;25(8):1405-1414
Lymphangiogenesis and angiogenesis in abdominal aortic aneurysm.
Sano M, Sasaki T, Hirakawa S, Sakabe J, Ogawa M, Baba S, Zaima N, Tanaka H, Inuzuka K, Yamamoto N, Setou M, Sato K, Konno H, Unno N
PloS one 2014;9(3):e89830
PloS one 2014;9(3):e89830
Molecular and Cellular Effects of In Vitro Shockwave Treatment on Lymphatic Endothelial Cells
Rohringer S, Holnthoner W, Hackl M, Weihs A, Rünzler D, Skalicky S, Karbiener M, Scheideler M, Pröll J, Gabriel C, Schweighofer B, Gröger M, Spittler A, Grillari J, Redl H, Dulak J
PLoS ONE 2014 December;9(12)
PLoS ONE 2014 December;9(12)
Adhesion of Pancreatic Cancer Cells in a Liver-Microvasculature Mimicking Coculture Correlates with Their Propensity to Form Liver-Specific Metastasis
Chowdhury M, Danoy M, Rahman F, Shinohara M, Kaneda S, Shiba K, Fujita N, Fujii T, Sakai Y
BioMed Research International 2014 ;2014
BioMed Research International 2014 ;2014
High density of peritumoral lymphatic vessels measured by D2-40/podoplanin and LYVE-1 expression in gastric cancer patients: an excellent prognostic indicator or a false friend?
Rudno-Rudzinska J, Kielan W, Grzebieniak Z, Dziegiel P, Donizy P, Mazur G, Knakiewicz M, Frejlich E, Halon A
Gastric Cancer 2013 October;16(4):513-520
Gastric Cancer 2013 October;16(4):513-520
A role for all-trans-retinoic acid in the early steps of lymphatic vasculature development.
Marino D, Dabouras V, Brändli AW, Detmar M
Journal of vascular research 2011;48(3):236-51
Journal of vascular research 2011;48(3):236-51
Lack of Evidence for the Direct Activation of Endothelial Cells by Adult Female and Microfilarial Excretory-Secretory Products
Weinkopff T, Lammie P, Diemert D
PLoS ONE 2011 August;6(8)
PLoS ONE 2011 August;6(8)
Thymus cell antigen 1 (Thy1, CD90) is expressed by lymphatic vessels and mediates cell adhesion to lymphatic endothelium
Jurisic G, Iolyeva M, Proulx S, Halin C, Detmar M
Experimental Cell Research 2010 October;316(17):2982-2992
Experimental Cell Research 2010 October;316(17):2982-2992
Endostatin inhibits tumour lymphangiogenesis and lymphatic metastasis via cell surface nucleolin on lymphangiogenic endothelial cells
Zhuo W, Luo C, Wang X, Song X, Fu Y, Luo Y
The Journal of Pathology 2010 November;222(3):249-260
The Journal of Pathology 2010 November;222(3):249-260
An exquisite cross-control mechanism among endothelial cell fate regulators directs the plasticity and heterogeneity of lymphatic endothelial cells
Kang J, Yoo J, Lee S, Tang W, Aguilar B, Ramu S, Choi I, Otu H, Shin J, Dotto G, Koh C, Detmar M, Hong Y
Blood 2010 July;116(1):140-150
Blood 2010 July;116(1):140-150
Suppression of Prostate Cancer Nodal and Systemic Metastasis by Blockade of the Lymphangiogenic Axis
Burton J, Priceman S, Sung J, Brakenhielm E, An D, Pytowski B, Alitalo K, Wu L
Cancer Research 2008 October;68(19):7828-7837
Cancer Research 2008 October;68(19):7828-7837
The lymphatic ring assay: a 3D-culture model of lymphangiogenesis
Françoise B, Laurence M, Sarah B, Olivier P, Jean-Michel F, Agnès N
Protocol Exchange 2008 May
Protocol Exchange 2008 May
Heterogeneity in Immunohistochemical, Genomic, and Biological Properties of Human Lymphatic Endothelial Cells Between Initial and Collecting Lymph Vessels
Kawai Y, Hosaka K, Kaidoh M, Minami T, Kodama T, Ohhashi T
Lymphatic Research and Biology 2008 March;6(1):15-27
Lymphatic Research and Biology 2008 March;6(1):15-27
Jugular Lymphatic Maldevelopment in Turner Syndrome and Trisomy 21: Different Anomalies Leading to Nuchal Edema
Bekker M, van den Akker N, de Mooij Y, Bartelings M, van Vugt J, Gittenberger-de Groot A
Reproductive Sciences 2008 March;15(3):295-304
Reproductive Sciences 2008 March;15(3):295-304
Endosialin (Tem1) Is a Marker of Tumor-Associated Myofibroblasts and Tumor Vessel-Associated Mural Cells
Christian S, Winkler R, Helfrich I, Boos A, Besemfelder E, Schadendorf D, Augustin H
The American Journal of Pathology 2008 February;172(2):486-494
The American Journal of Pathology 2008 February;172(2):486-494
Altered regulation of Prox1-gene-expression in liver tumors
Dudas J, Mansuroglu T, Moriconi F, Haller F, Wilting J, Lorf T, Füzesi L, Ramadori G
BMC Cancer 2008 December;8(1)
BMC Cancer 2008 December;8(1)
Similarities and differences of human and experimental mouse lymphangiomas
Kasten P, Schnöink G, Bergmann A, Papoutsi M, Buttler K, Rössler J, Weich H, Wilting J
Developmental Dynamics 2007 October;236(10):2952-2961
Developmental Dynamics 2007 October;236(10):2952-2961
Melanoma contains CD133 and ABCG2 positive cells with enhanced tumourigenic potential
Monzani E, Facchetti F, Galmozzi E, Corsini E, Benetti A, Cavazzin C, Gritti A, Piccinini A, Porro D, Santinami M, Invernici G, Parati E, Alessandri G, La Porta C
European Journal of Cancer 2007 March;43(5):935-946
European Journal of Cancer 2007 March;43(5):935-946
Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1
Kilic N, Oliveira-Ferrer L, Neshat-Vahid S, Irmak S, Obst-Pernberg K, Wurmbach J, Loges S, Kilic E, Weil J, Lauke H, Tilki D, Singer B, Ergun S
Blood 2007 December;110(13):4223-4233
Blood 2007 December;110(13):4223-4233
Induction of lymphangiogenesis in and around axillary lymph node metastases of patients with breast cancer
Van den Eynden G, Van der Auwera I, Van Laere S, Huygelen V, Colpaert C, van Dam P, Dirix L, Vermeulen P, Van Marck E
British Journal of Cancer 2006 October;95(10):1362-1366
British Journal of Cancer 2006 October;95(10):1362-1366
Differentiation of Lymphatic Endothelial Cells From Embryonic Stem Cells on OP9 Stromal Cells
Kono T
Arteriosclerosis, Thrombosis, and Vascular Biology 2006 June;26(9):2070-2076
Arteriosclerosis, Thrombosis, and Vascular Biology 2006 June;26(9):2070-2076
Isolation and characterization of lymphatic microvascular endothelial cells from human tonsils
Garrafa E, Alessandri G, Benetti A, Turetta D, Corradi A, Cantoni A, Cervi E, Bonardelli S, Parati E, Giulini S, Ensoli B, Caruso A
Journal of Cellular Physiology 2006 April;207(1):107-113
Journal of Cellular Physiology 2006 April;207(1):107-113
Tumor Lymphangiogenesis in Inflammatory Breast Carcinoma: A Histomorphometric Study
Van der Auwera I
Clinical Cancer Research 2005 November;11(21):7637-7642
Clinical Cancer Research 2005 November;11(21):7637-7642
Isolation, purification, and heterogeneity of human lymphatic endothelial cells from different tissues.
Garrafa E, Trainini L, Benetti A, Saba E, Fezzardi L, Lorusso B, Borghetti P, Bottio T, Ceri E, Portolani N, Bonardlli S, Giulini SM, Annibale G, Corradi A, Imberti L, Caruso A
Lymphology 2005 Dec;38(4):159-66
Lymphology 2005 Dec;38(4):159-66
Elevated expression of VEGFR-3 in lymphatic endothelial cells from lymphangiomas
Norgall S, Papoutsi M, Rössler J, Schweigerer L, Wilting J, Weich H
BMC Cancer ;7(1):105
BMC Cancer ;7(1):105
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Western analysis of recombinant human sLYVE-1 [Cat# S01-028] and mouse sLYVE-1 [Cat# S01-026] using an anti-human LYVE-1 polyclonal antibody [Cat# 102-PA50] directed against the extracellular domain of human LYVE-1. There is more or less no cross reactivity with mouse LYVE-1.
- Sample type
- Purified recombinant proteins
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Cryo sections of human colon carcinoma labeled with rabbit polyclonal antibody against human LYVE-1 (red) [Cat# 102-PA50] and human CD31 (green). A: CD31; B: LYVE-1; C: CD31/LYVE-1
- Sample type
- Human colon carcinoma tissue
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- IHC with human spleen tissue sections. The experiment was performed by Prof. Dr. Birte Steiniger, Institute of Anatomy and Cell Biology Robert-Koch-Str. 8, D-35037 Marburg, Germany
- Sample type
- Human Spleen
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- FACS analysis with primary human dermal microvascular endothelial cells (HDMVEC).
- Sample type
- HDMVEC