Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310897 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Glucosaminyl (N-Acetyl) Transferase 4, Core 2 (Beta-1,6-N-Acetylglucosaminyltransferase) (GCNT4) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GCNT4 antibody: synthetic peptide directed towards the C terminal of human GCNT4
- Description
- Affinity Purified
- Reactivity
- Human, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDL
QSKTR LVKWNYYEGF- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Control of O-glycan branch formation. Molecular cloning and characterization of a novel thymus-associated core 2 beta1, 6-n-acetylglucosaminyltransferase.
Schwientek T, Yeh JC, Levery SB, Keck B, Merkx G, van Kessel AG, Fukuda M, Clausen H
The Journal of biological chemistry 2000 Apr 14;275(15):11106-13
The Journal of biological chemistry 2000 Apr 14;275(15):11106-13
No comments: Submit comment
No validations: Submit validation data