PAB20633

SPX antibody from Abnova Corporation
C12orf39, MGC10946, NPQ, spexin

Antibody data

Product number
PAB20633
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20633, RRID:AB_10961866
Product name
C12orf39 polyclonal antibody
Provider product page
Abnova Corporation - PAB20633
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human C12orf39.
Reactivity
Human
Host
Rabbit
Antigen sequence
APQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRK
DLSDRPLPERRSPNPQLLTIPEAATILLASLQKSP
EDEEKNFDQTRFLEDSLLNW
Isotype
IgG
Vial size
100 µl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.